Edit |   |
---|---|
Antigenic Specificity | SUR2B |
Clone | N323A/31 |
Host Species | n/a |
Reactive Species | rat; mouse; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-SUR1 and SUR2B BBB Shuttle Antibody, Clone N323A/31 |
Immunogen | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2) Mouse: 100% identity (43/43 amino acids identical) Human: 97% identity (42/43 amino acids identical) >75% identity with SUR1 |
Other Names | SUR1; SUR2B |
Gene, Accession # | n/a |
Catalog # | NRZP-0423-ZP400 |
Price | please inquire |
Order / More Info | SUR2B Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |