Edit |   |
---|---|
Antigenic Specificity | ABCC9 |
Clone | monoclonal |
Host Species | Recombinant Rat |
Reactive Species | rat |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | ICC, WB, IHC, |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rat Anti-Abcc9 Recombinant Antibody (VS-0522-LC45). This product is a rat antibody that recognizes Abcc9 protein of rat. |
Immunogen | A fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat Abcc9. |
Other Names | Sur2; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C, member 9-like; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; Sulfonylurea receptor 2 |
Gene, Accession # | UniProt: Q63563 |
Catalog # | VS-0522-LC45 |
Price | please inquire |
Order / More Info | ABCC9 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |