Edit |   |
---|---|
Antigenic Specificity | Brn-2 |
Clone | CBP1225 |
Host Species | Mouse |
Reactive Species | mouse; human; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | ICC; IF; IHC-P; WB; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-POU3F2 Monoclonal Antibody (CBP1225) |
Immunogen | Recombinant fragment corresponding to Human Brn-2 aa 5-54. Sequence: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP Database link: P20265 |
Other Names | POU3F2; BRN2; N-Oct3; OCT7; OTF-7; OTF7; POUF3; brn-2; oct-7; POU class 3 homeobox 2 |
Gene, Accession # | UniProt: UniProt: UniProt: P56222 |
Catalog # | NAB-0720-Z4614 |
Price | please inquire |
Order / More Info | Brn-2 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |