Edit |   |
---|---|
Antigenic Specificity | ABCC8 |
Clone | monoclonal |
Host Species | Recombinant Rat |
Reactive Species | hamster, rat, mouse |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB, |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rat Anti-Abcc8 Recombinant Antibody (VS-0522-LC42). This product is a rat antibody that recognizes Abcc8 protein of Hamster, rat, mouse. |
Immunogen | A fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat Abcc8. |
Other Names | Sur; Sur1; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; ATP-binding cassette, subfamily C (CFTR/MRP), member 8; sulfonylurea receptor 1; sulphonylurea receptor 1 |
Gene, Accession # | UniProt: Q09429 |
Catalog # | VS-0522-LC42 |
Price | please inquire |
Order / More Info | ABCC8 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |