Edit |   |
---|---|
Antigenic Specificity | SCN2A |
Clone | K69/3 |
Host Species | n/a |
Reactive Species | rat; mouse; human; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; IP; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-Nav1.2 sodium channel BBB Shuttle Antibody, Clone K69/3 |
Immunogen | Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus, RFMASNPSKVSYEPI TTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDIITD KLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK) of rat Voltage-gated sodium channel subunit alpha Nav1.2, Sodium channel protein type 2 subunit alpha, Sodium channel protein brain II subunit alpha, HBSC II, NAC2, Scn2a, Scn2a1, Scn2a2, accession number P04775) Mouse: 100% identity (124/124 amino acids identical) Human: 94% identity (117/124 amino acids identical) >60% identity with Nav1.1, Nav1.3 and Nav1.7 |
Other Names | Sodium Voltage-Gated Channel Alpha Subunit 2; Sodium Channel; Voltage-Gated; Type II; Alpha 2 Polypeptide; Sodium Channel; Voltage-Gated; Type II; Alpha 1 Polypeptide; Sodium Channel; Voltage-Gated; Type II; Alpha Subunit; Voltage-Gated Sodium Channel Subunit Alpha Nav1.2; Sodium Channel Protein Brain II Subunit Alpha; Sodium Channel Protein Type II Subunit Alpha; HBSC II; SCN2A1; SCN2A2; NAC2; Sodium Channel; Voltage Gated; Type II Alpha Subunit; Sodium Channel Protein; Brain Type 2 Alpha Subunit; |
Gene, Accession # | UniProt: P04775 |
Catalog # | NRZP-0423-ZP279 |
Price | please inquire |
Order / More Info | SCN2A Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |