Edit |   |
---|---|
Antigenic Specificity | MZB1 |
Clone | monoclonal |
Host Species | Recombinant Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | ELISA, FC, |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Anti-MZB1 Recombinant Antibody (HPAB-0132-CN). This product is a recombinant Rabbit antibody that recognizes MZB1. The antibody was expressed in mammalian cells with chemically defined culture media and was purified by affinity chromatography. |
Immunogen | Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
Other Names | PACAP; pERp1; MEDA-7 |
Gene, Accession # | UniProt: Q8WU39 |
Catalog # | HPAB-0132-CN |
Price | please inquire |
Order / More Info | MZB1 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |