Edit |   |
---|---|
Antigenic Specificity | KCNJ4 |
Clone | CBP786 |
Host Species | Mouse |
Reactive Species | mouse; rat; human; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | IHC-P; IHC-Fr; WB; ICC; IF; FC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-KCNJ4 Monoclonal Antibody (CBP786) |
Immunogen | Fusion protein corresponding to Human KIR2.3/HIR aa 390-445. Sequence: AAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQAATLPLDNISY RRESAI Database link: NP_032453 |
Other Names | KCNJ4; HIR; HIRK2; HRK1; IRK-3; IRK3; Kir2.3; potassium voltage-gated channel subfamily J member 4; potassium inwardly rectifying channel subfamily J member 4 |
Gene, Accession # | UniProt: UniProt: UniProt: P52190 |
Catalog # | NAB-0720-Z3020 |
Price | please inquire |
Order / More Info | KCNJ4 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |