Edit |   |
---|---|
Antigenic Specificity | mAChR M1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | antigen affinity purified |
Size | 50 µl |
Concentration | 0.95 mg/ml |
Applications | ICC/IF, IHC-Fr, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-mAChR M1 polyclonal antibody. |
Immunogen | GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 ( 3rd intracellular loop) of human M1 (Accession : P11229). |
Other Names | cholinergic receptor muscarinic 1 , HM1 , M1 , M1R |
Gene, Accession # | Gene ID: 1128, UniProt: P11229 |
Catalog # | GTX17525 |
Price | $639 |
Order / More Info | mAChR M1 Antibody from GENETEX INC. |
Product Specific References | n/a |