Edit |   |
---|---|
Antigenic Specificity | IL22 Receptor alpha 2 |
Clone | polyclonal |
Host Species | Goat |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 100 µg |
Concentration | 1 mg/ml |
Applications | ELISA, IHC-P |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Goat anti-IL22 Receptor alpha 2 polyclonal antibody. |
Immunogen | Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein |
Other Names | CRF210,CRF2S1,CRF2X,IL22BP,IL22RA2,IL22Ralpha2,ZCYTOR16,interleukin 22 receptor subunit alpha 2,IL22 Receptor alpha 2 |
Gene, Accession # | UniProt: Q969J5 |
Catalog # | GTX18566 |
Price | $399 |
Order / More Info | IL22 Receptor alpha 2 Antibody from GENETEX INC. |
Product Specific References | n/a |