DcR1 Antibody from GENETEX INC.
Search, find, compare suppliers for anti-DcR1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | DcR1 |
| Clone | polyclonal |
| Host Species | Goat |
| Reactive Species | chimpanzee, human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 µg |
| Concentration | 1 mg/ml |
| Applications | ELISA, FACS, IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Goat anti-DcR1 polyclonal antibody. |
| Immunogen | Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1) |
| Other Names | CD263,DCR1,DCR1TNFR,LIT,TNF receptor superfamily member 10c,TNFRSF10C,TRAILR3,TRID,DcR1,TRAIL-R3 |
| Gene, Accession # | UniProt: O14798 |
| Catalog # | GTX21674 |
| Price | $399 |
| Order / More Info | DcR1 Antibody from GENETEX INC. |
| Product Specific References | n/a |
GENETEX INC.
GENETEX INC.
2456 Alton Pkwy
Irvine CA 92606
P: 1-949-553-1900
P: 1-877-GeneTex(436-3839)
F: 1-949-309-2888
info@genetex.com
Sales: sales@genetex.com
Technical Support: support@genetex.com
http://www.genetex.com
Profile of GENETEX INC.