Edit |   |
---|---|
Antigenic Specificity | Lobster Alpha IV Tubulin (OET-10) |
Clone | OET-10 |
Host Species | Rabbit |
Reactive Species | lobster |
Isotype | n/a |
Format | unconjugated |
Size | 100uL |
Concentration | n/a |
Applications | Untested |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Anti-Lobster Alpha IV Tubulin (OET-10) Antibody. Target: lobster alpha IV tubulin (OET-10; lobster α-tubulin). Epitope: MVSGGRECISMHVGQAGVQMGNACWELYCLEHGIQADGGMIMDETEPNQPYIANDSFNTFFNETRMGKHVPRAVFIDLEPSVVDEI |
Immunogen | Peptide |
Other Names | n/a |
Gene, Accession # | Accession: P68366, AAL04106 |
Catalog # | EKY006 |
Price | $328 |
Order / More Info | Lobster Alpha IV Tubulin (OET-10) Antibody from KERAFAST, INC. |
Product Specific References | n/a |