Zika Virus Envelope (E) Protein, ED3 Domain Antibody from KERAFAST, INC.
Search, find, compare suppliers for anti-Zika Virus Envelope (E) Protein, ED3 Domain antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Zika Virus Envelope (E) Protein, ED3 Domain |
| Clone | 3E10D1 |
| Host Species | Mouse |
| Reactive Species | Zika virus |
| Isotype | IgG2b,k |
| Format | unconjugated |
| Size | 100ug |
| Concentration | n/a |
| Applications | IF (1: 2000); showed suitability for WB and IFA (1µg/ml for WB and 0.1-10µg/mL for IFA) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-Zika Virus Envelope (E) Protein, ED3 Domain [3E10D1] Antibody. Target: Zika virus ED3 |
| Immunogen | Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti) |
| Other Names | n/a |
| Gene, Accession # | Accession: A0A142I5B9, A0A1C8L488 |
| Catalog # | EUL013 |
| Price | $336 |
| Order / More Info | Zika Virus Envelope (E) Protein, ED3 Domain Antibody from KERAFAST, INC. |
| Product Specific References | n/a |
KERAFAST, INC.
KERAFAST, INC.
An Absolute Biotech Company
2 Shaker Road, Unit B101
Shirley MA 01464
P: +1-617-336-3228
P: +1-800-546-1760
F: +1-866-727-9826
info@kerafast.com
Tech Support: TechnicalSupport@kerafast.com
https://www.kerafast.com
Profile of KERAFAST, INC.
Return to Antibodies