Edit |   |
---|---|
Antigenic Specificity | Ferroportin (SLC40A1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100uL |
Concentration | n/a |
Applications | WB (1:1000), IHC (1:500) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Anti-Ferroportin (SLC40A1) Antibody. Target: Mouse FPN. Epitope: RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV |
Immunogen | GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse Fpn |
Other Names | n/a |
Gene, Accession # | Accession: Q9NP59 |
Catalog # | EMG009 |
Price | $328 |
Order / More Info | Ferroportin (SLC40A1) Antibody from KERAFAST, INC. |
Product Specific References |
|