GRN / Granulin Antibody from LIFESPAN BIOSCIENCES INC.

Search, find, compare suppliers for anti-GRN / Granulin antibody, protein, ELISA kits.

Antigenic SpecificityGRN / Granulin
Host SpeciesRabbit
Reactive Specieshuman
Formataffinity purified
Size100 µl, 200 µl, 50 µl
ApplicationsIHC (1:50 - 1:200), WB (1:500 - 1:2000)
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionGranulin antibody LS-C747542 is an unconjugated rabbit polyclonal antibody to human Granulin (GRN ). Validated for IHC and WB.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human GRN (NP_002078.1). DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE
Other NamesGRN, Acrogranin, CLN11, Epithelin precursor, GEP, gp88, Granulin, Granulin-epithelin, Granulins, PC cell-derived growth factor, PCDGF, PEPI, PGRN, Proepithelin, Progranulin
Gene, Accession #GRN, Gene ID: 2896
Catalog #LS-C747542
Priceplease inquire
Order / More InfoGRN / Granulin Antibody from LIFESPAN BIOSCIENCES INC.
Product Specific Referencesn/a
2401 Fourth Avenue, Suite 900
Seattle WA 98121
P: 206-374-1102
P: 866-819-4732 (toll free N. America)
F: 206-577-4565
Tech Support:

Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.