E74 like factor 1 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-E74 like factor 1 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | E74 like factor 1 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.Protein Function: Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE). Subcellular Localization: Nucleus. Tissue Specificity: In fetal tissues, it is highly expressed in heart, lung liver and kidney, and weakly expressed in brain. In adult, it is highly expressed in pancreas, spleen, thymus and peripheral blood leukocytes, expressed at moderate levels in heart, placenta, lung, liver, skeletal muscle, kidney, prostate, ovary, small intestin |
| Other Names | [ETS-related transcription factor Elf-1; E74-like factor 1; ELF1] |
| Gene, Accession # | [ELF1], Gene ID: 1997, NCBI: NP_001138825.1, UniProt: P32519 |
| Catalog # | MBS1750818 |
| Price | $280 |
| Order / More Info | E74 like factor 1 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies