Edit |   |
---|---|
Antigenic Specificity | PTOV1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.4 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a protein that was found to be overexpressed in prostate adenocarcinomas. The encoded protein was found to interact with the lipid raft protein flotillin-1 and shuttle it from the cytoplasm to the nucleus in a cell cycle dependent manner. Alternative splicing of this gene results in multiple transcript variants. |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTOV1 (NP 001292037.1). Immunogen Sequence: MRSPAVPTPARGQLGVAFVLLPPHSEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLE |
Other Names | [PTOV1; ACID2; PTOV-1; prostate tumor overexpressed 1] |
Gene, Accession # | [PTOV1], Gene ID: 53635, NCBI: NP_001292034.1, UniProt: Q86YD1 |
Catalog # | MBS9140730 |
Price | $260 |
Order / More Info | PTOV1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |