Human Bax Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Human Bax antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Human Bax |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | DyLight 488 conjugate |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tu |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. |
| Other Names | [Rabbit IgG Human Bax DyLight 488 Conjugated, Flow Validated; Apoptosis regulator BAX; Bcl-2-like protein 4; Bcl2-L-4; BAX; BCL2L4; BCL2-associated X protein] |
| Gene, Accession # | [Bax], Gene ID: 581, NCBI: NP_001278357.1, UniProt: Q07812 |
| Catalog # | MBS1751220 |
| Price | $330 |
| Order / More Info | Human Bax Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Apte, S. S.; Mattei, M.-G.; Olsen, B. R.: Mapping of human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX-delta. Genomics 26: 592-594, 1995. 2. Guo, B.; Zhai, D.; Cabezas, E.; Welsh, K.; Nouraini, S.; Satterthwait, A. C.; Reed, J. C.: Humanin peptide suppresses apoptosis by interfering with Bax activation. Nature 423: 456-461, 2003. 3. Oltvai, Z. N.; Milliman, C. L.; Korsmeyer, S. J.: Bcl-2 heterodimers in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell 74: 609-619, 1993. 4. Takeuchi, O.; Fisher, J.; Suh, H.; Harada, H.; Malynn, B. A.; Korsmeyer, S. J.: Essential role of BAX, BAK in B cell homeostasis and prevention of autoimmune disease. Proc. Nat. Acad. Sci. 102: 11272-11277, 2005. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies