Edit |   |
Antigenic Specificity | BMP5 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human;Mouse;Rat. Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act a |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. Ig Type: Rabbit IgG |
Other Names | [Bone morphogenetic protein 5; BMP 5; BMP-5; Bmp5; BMP5_HUMAN; Bone morphogenetic protein 5; MGC34244; bone morphogenetic protein 5], [BMP5; BMP5; BMP-5] |
Gene, Accession # | [BMP5], Gene ID: 653, NCBI: NP_066551.1, UniProt: P22003 |
Catalog # | MBS178341 |
Price | $315 |
Order / More Info | BMP5 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: BMP5 bone morphogenetic protein 5. 2. Beck HN, Drahushuk K, Jacoby DB, Higgins D, Lein PJ (Mar 2003). Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons. BMC Neurosci 2: 12. 3. Hahn GV, Cohen RB, Wozney JM, Levitz CL, Shore EM, Zasloff MA, Kaplan FS (Dec 1992). A bone morphogenetic protein subfamily: chromosomal localization of human genes for BMP5, BMP6, and BMP7. Genomics 14 (3): 759-62. |