LRIG1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-LRIG1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | LRIG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for LRIG1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It is mapped to 3p14.1. Leucine-rich repeats and immunoglobulin-like domains protein 1 is a protein that in humans is encoded by the LRIG1 gene. It encodes a transmembrane protein that has been shown to interact with receptor tyrosine kinases of the EGFR-family, MET and RET. This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair proces |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human LRIG1 (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI). |
| Other Names | [Leucine-rich repeats and immunoglobulin-like domains protein 1; LIG-1; Leucine rich repeats and immunoglobulin like domains 1] |
| Gene, Accession # | [LRIG1], Gene ID: 26018, NCBI: NP_056356.2, UniProt: Q96JA1 |
| Catalog # | MBS1751475 |
| Price | $315 |
| Order / More Info | LRIG1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Guo, D., Holmlund, C., Henriksson, R., Hedman, H. The LRIG gene family has three vertebrate paralogs widely expressed in human and mouse tissues and a homolog in Ascidiacea. Genomics 84: 157-165, 2004. 2. Jensen, K. B., Watt, F. M. Single-cell expression profiling of human epidermal stem and transit-amplifying cells: Lrig1 is a regulator of stem cell quiescence. Proc. Nat. Acad. Sci. 103: 11958-11963, 2006. 3. Nilsson, J., Vallbo, C., Guo, D., Golovleva, I., Hallberg, B., Henriksson, R., Hedman, H. Cloning, characterization, and expression of human LIG1.Biochem. Biophys. Res. Commun. 284: 1155-1161, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies