NKG2D Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-NKG2D Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | NKG2D Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, ratpredicted reactivity: human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: NKG2D is encoded by KLRK1 gene which is located in the NK-gene complex (NKC) situated on and chromosome 12 in humans. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane ori |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH). Subcellular Localization: Cell membrane. Tissue Specificity: Expressed in natural killer (NK) cells, CD8( ) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56 CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). |
| Other Names | [NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD314; KLRK1; D12S2489E; NKG2D] |
| Gene, Accession # | [NKG2D], Gene ID: 100528032, NCBI: NP_001186734.1, UniProt: P26718 |
| Catalog # | MBS1750460 |
| Price | $280 |
| Order / More Info | NKG2D Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies