Edit |   |
---|---|
Antigenic Specificity | HNRPD |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal HNRPD antibody |
Immunogen | Immunogen: HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK |
Other Names | [HNRPD; HNRPD; Au-Rich Element Rna Binding Protein 2; Heterogeneous Nuclear Ribonucleoprotein D], [HNRNPD; HNRNPD; P37; AUF1; AUF1A; HNRPD; hnRNPD0; AUF1; HNRPD; hnRNP D0] |
Gene, Accession # | [HNRPD], Gene ID: 3184, NCBI: AAC23476.1 |
Catalog # | MBS839746 |
Price | $355 |
Order / More Info | HNRPD Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |