Frizzled 4 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Frizzled 4 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Frizzled 4 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Protein Function: Receptor for Wnt proteins. Most of frizzled receptors are couple |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY). Subcellular Localization: Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Tissue Specificity: Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and |
| Other Names | [Frizzled-4; Fz-4; hFz4; FzE4; CD344; FZD4] |
| Gene, Accession # | [FZD4], Gene ID: 8322, NCBI: NP_036325.2, UniProt: Q9ULV1 |
| Catalog # | MBS1750751 |
| Price | $315 |
| Order / More Info | Frizzled 4 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies