SOD3/Ec Sod Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SOD3/Ec Sod Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SOD3/Ec Sod Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: SOD3 (SUPEROXIDE DISMUTASE 3), also called SUPEROXIDE DISMUTASE, EXTRACELLULAR, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD). Subcellular Localization: Secreted, extracellular space. 99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium. Tissue Specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph a |
| Other Names | [Extracellular superoxide dismutase [Cu-Zn]; EC-SOD; 1.15.1.1; SOD3] |
| Gene, Accession # | [SOD3], Gene ID: 6649, NCBI: NP_003093.2, UniProt: P08294 |
| Catalog # | MBS1750716 |
| Price | $315 |
| Order / More Info | SOD3/Ec Sod Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies