Human CD5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Human CD5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Human CD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | DyLight 488 conjugate |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). |
| Other Names | [Rabbit IgG Human CD5 DyLight 488 Conjugated, Flow Validated; T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1; CD5 molecule] |
| Gene, Accession # | [CD5], Gene ID: 921, NCBI: NP_001333385.1, UniProt: P06127 |
| Catalog # | MBS1751252 |
| Price | $330 |
| Order / More Info | Human CD5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Lundell, A.-C., Johansen, S., Adlerberth, I., Wold, A. E., Hesselmar, B., Rudin, A. High proportion of CD5 B cells in infants predicts development of allergic disease. J. Immun. 193: 510-518, 2014. 2. Zhang, C., Xin, H., Zhang, W., Yazaki, P. J., Zhang, Z., Le, K., Li, W., Lee, H., Kwak, L., Forman, S., Jove, R., Yu, H. CD5 binds to interleukin-6 and induces a feed-forward loop with the transcription factor STAT3 in B cells to promote cancer. Immunity 44: 913-923, 2016. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies