Edit |   |
---|---|
Antigenic Specificity | CYP27C1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: CYP27C1 antibody was raised against the middle region of CYP27C1. Rabbit polyclonal CYP27C1 antibody raised against the middle region of CYP27C1 |
Immunogen | Immunogen: CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL |
Other Names | [CYP27C1; CYP27C1; FLJ16008; CYPC1 27; CYP27C1; Cytochrome P450 Family 27 Subfamily C Polypeptide 1; CYPC1-27] |
Gene, Accession # | [CYP27C1] |
Catalog # | MBS5301597 |
Price | $430 |
Order / More Info | CYP27C1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |