DARPP32 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-DARPP32 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | DARPP32 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Protein phosphatase 1 regulatory subunit 1B; DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; Protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1 regulatory inhibitor subunit 1B], [PPP1R1B; PPP1R1B; DARPP32; DARPP-32; DARPP32] |
| Gene, Accession # | [DARPP32], Gene ID: 84152, NCBI: NP_001229393.1, UniProt: Q9UD71 |
| Catalog # | MBS177854 |
| Price | $315 |
| Order / More Info | DARPP32 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32). 2. Brene S, Lindefors N, Ehrlich M, Taubes T, Horiuchi A, Kopp J, Hall H, Sedvall G, Greengard P, Persson H (March 1994). Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue. J. Neurosci. 14 (3 Pt 1): 985-98. 3. Ouimet CC, Greengard P (February 1990). Distribution of DARPP-32 in the basal ganglia: an electron microscopic study. J. Neurocytol. 19 (1): 39-52. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies