Edit |   |
---|---|
Antigenic Specificity | NOL5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal NOL5A antibody |
Immunogen | Immunogen: NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK |
Other Names | [NOL5A; NOL5A; NOLA-5; NOLA 5; Nucleolar Protein 5A; NOP56; NOL5A; 56Kda With Kke/D Repeat] |
Gene, Accession # | [NOL5A] |
Catalog # | MBS5302830 |
Price | $430 |
Order / More Info | NOL5A Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |