galectin 9 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-galectin 9 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | galectin 9 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | rat. predicted to work with: human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for galectin 9(LGALS9) detection. Tested with WB in Human;Rat. Background: Galectin-9 is a protein that in humans is encoded by the LGALS9 gene. It is mapped to 17q11.2. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. Ig Type: Rabbit IgG |
| Other Names | [Galectin-9; Ecalectin; Gal-9; Galectin-9; galectin9; HOM HD 21; HOMHD21; HUAT; Lectin galactoside binding soluble 9; LEG9_HUMAN; LGAL S9; LGALS 9; Lgals9; LGALS9A; MGC117375; MGC125973; MGC125974; Tumor antigen HOM-HD-21; Urate transporter/channel protein; lectin, galactoside-binding, soluble, 9], [LGALS9; LGALS9; HUAT; LGALS9A; Gal-9] |
| Gene, Accession # | Gene ID: 3965, NCBI: NP_002299.2, UniProt: O00182 |
| Catalog # | MBS178073 |
| Price | $280 |
| Order / More Info | galectin 9 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: LGALS9 lectin, galactoside-binding, soluble, 9 (galectin 9). 2. Tureci O, Schmitt H, Fadle N, Pfreundschuh M, Sahin U (Apr 1997). Molecular definition of a novel human galectin which is immunogenic in patients with Hodgkin's disease. J Biol Chem 272 (10): 6416-22. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies