UHRF1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-UHRF1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | UHRF1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human. Background: Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub pro |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [E3 ubiquitin-protein ligase UHRF1; Ac2-121; AL022808; E3 ubiquitin-protein ligase UHRF1; EC 6.3.2.-; FLJ21925; hNP95; hUHRF1; HuNp95; ICBP90; Inverted CCAAT box binding protein of 90 kDa; Inverted CCAAT box binding protein, 90-kD; Inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; NP95; Nuclear phosphoprotein, 95-KD; Nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RNF106; Transcription factor ICBP90; Ubiquitin like containing PHD and RING finger domains protein 1; Ubiquitin like PHD and RING finger domain containing protein 1; Ubiquitin-like PHD and RING finger domain-containing protein 1; Ubiquitin-like protein containing PHD and RING finger domains 1; Ubiquitin-like with PHD and ring finger domains 1; Ubiquitin-like, containing PHD and RING finger domains, 1; Ubiquitin-like-containing PHD and RING finger domains protein 1; UHRF1; UHRF1_HUMAN; ubiquitin-like with PHD and ring finger domains 1], [UHRF1; UHRF1; Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95; ICBP90; NP95; RNF106; HuNp95; hNp95; hUHRF1] |
| Gene, Accession # | [UHRF1], Gene ID: 29128, NCBI: NP_001041666.1, UniProt: Q96T88 |
| Catalog # | MBS177743 |
| Price | $315 |
| Order / More Info | UHRF1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: UHRF1 ubiquitin-like, containing PHD and RING finger domains, 1. 2. Hopfner R, Mousli M, Jeltsch JM, Voulgaris A, Lutz Y, Marin C, Bellocq JP, Oudet P, Bronner C (Jan 2000).ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression.Cancer Research 60 (1): 121-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies