Galectin 8 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Galectin 8 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Galectin 8 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human;Rat. Background: Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have bee |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids. Ig Type: Rabbit IgG |
| Other Names | [Galectin-8; Gal 8; Gal-8; Gal8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP; Po66-CBP; Prostate carcinoma tumor antigen 1; lectin, galactoside-binding, soluble, 8], [LGALS8; LGALS8; Gal-8; PCTA1; PCTA-1; Po66-CBP; Gal-8; Po66-CBP; PCTA-1] |
| Gene, Accession # | Gene ID: 3964, NCBI: NP_006490.3, UniProt: O00214 |
| Catalog # | MBS178158 |
| Price | $280 |
| Order / More Info | Galectin 8 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: LGALS8 lectin, galactoside-binding, soluble, 8 (galectin 8). 2. Hadari YR, Paz K, Dekel R, Mestrovic T, Accili D, Zick Y (Mar 1995). Galectin-8. A new rat lectin, related to galectin-4. J Biol Chem 270 (7): 3447-53. 3. Su ZZ, Lin J, Shen R, Fisher PE, Goldstein NI, Fisher PB (Aug 1996). Surface-epitope masking and expression cloning identifies the human prostate carcinoma tumor antigen gene PCTA-1 a member of the galectin gene family. Proc Natl Acad Sci U S A 93 (14): 7252-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies