Calcitonin/Calca Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Calcitonin/Calca antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Calcitonin/Calca |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for Calcitonin detection. Tested with IHC-P in Human; Mouse; Rat.Background: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP). |
| Other Names | [Calcitonin; Calca; Calc; Calcitonin-related polypeptide, alpha] |
| Gene, Accession # | [Calca], Gene ID: 12310, NCBI: NP_001292545.1, UniProt: P70160 |
| Catalog # | MBS1751418 |
| Price | $315 |
| Order / More Info | Calcitonin/Calca Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Alevizaki, M., Stevenson, J. C., Girgis, S. I., MacIntyre, I., Legon, S. Altered calcitonin gene in a young patient with osteoporosis.Brit. Med. J. 298: 1215-1216, 1989. Note: Retraction: Brit. Med. J. 299: 235 only, 1989. 2. Breimer, L. H., MacIntyre, I., Zaidi, M. Peptides from the calcitonin genes: molecular genetics, structure and function. Biochem. J. 255: 377-390, 1988. 3. Edbrooke, M. R., Parker, D., McVey, J. H., Riley, J. H., Sorenson, G. D., Pettengill, O. S., Craig, R. K. Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 4: 715-724, 1985. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies