Hsp70 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Hsp70 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Hsp70 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B(HSPA1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No pro |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [Heat shock 70 kDa protein 1A/1B; DAQB 147D11.1 001; FLJ54303; FLJ54370; FLJ54392; FLJ54408; FLJ75127; Heat shock 70 kDa protein 1; Heat shock 70 kDa protein 1/2; Heat shock 70 kDa protein 1A/1B; heat shock 70kDa protein 1A; Heat shock 70kDa protein 1B; Heat shock induced protein; heat shock protein 70; HSP70 1; HSP70 2; HSP70-1/HSP70-2; HSP70-1A; HSP70.1; HSP70.1/HSP70.2; HSP70I; HSP71_HUMAN; HSP72; HSPA1; HSPA1A; HSPA1B; XXbac BCX40G17.3 001; heat shock 70kDa protein 1A], [HSPA1A; HSPA1A; HSP72; HSPA1; HSP70I; HSP70-1; HSP70.1; HSP70-1A; HEL-S-103; HSPA1; HSX70; HSP70.1] |
| Gene, Accession # | [Hsp70], Gene ID: 3303, NCBI: NP_005336.3, UniProt: P0DMV8 |
| Catalog # | MBS178358 |
| Price | $315 |
| Order / More Info | Hsp70 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Becker, T., Hartl, F.-U., Wieland, F. CD40, an extracellular receptor for binding and uptake of Hsp70-peptide complexes. J. Cell Biol. 158: 1277-1285, 2002. 2. Gehrig, S. M., van der Poel, C., Sayer, T. A., Schertzer, J. D., Henstridge, D. C., Church, J. E., Lamon, S., Russell, A. P., Davies, K. E., Febbraio, M. A., Lynch, G. S. Hsp72 preserves muscle function and slows progression of severe muscular dystrophy. Nature 484: 394-398, 2012. 3. Shimizu, S., Nomura, K., Ujihara, M., Demura, H. An additional exon of stress-inducible heat shock protein 70 gene (HSP70-1). Biochem. Biophys. Res. Commun. 257: 193-198, 1999. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies