SLC25A5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC25A5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC25A5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.1 mL |
| Concentration | 1.16 mg/ml |
| Applications | Western Blot (WB), Immunofluorescence (IF) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC25A5 (NP 001143.2). Immunogen Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIM |
| Other Names | [SLC25A5; 2F1; AAC2; ANT2; T2; T3; ADP/ATP translocase 2] |
| Gene, Accession # | [SLC25A5], Gene ID: 292, NCBI: NP_001143.2, UniProt: P05141 |
| Catalog # | MBS9140399 |
| Price | $260 |
| Order / More Info | SLC25A5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies