PDGFRA Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PDGFRA antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PDGFRA |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in diffe |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Platelet-derived growth factor receptor alpha; Alpha platelet derived growth factor receptor; Alpha-type platelet-derived growth factor receptor; CD 140a; CD140 antigen-like family member A; CD140a; CD140a antigen; MGC74795; PDGF alpha chain; PDGF R alpha; PDGF-R-alpha; PDGFR 2; PDGFR A; PDGFR alpha; PDGFR2; PDGFRA; PDGFRA/BCR fusion; PGFRA_HUMAN; Platelet derived growth factor receptor 2; Platelet derived growth factor receptor alpha; Platelet derived growth factor receptor alpha polypeptide; Platelet derived growth factor receptor; Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein; RHEPDGFRA; platelet-derived growth factor receptor, alpha polypeptide], [PDGFRA; PDGFRA; GAS9; CD140A; PDGFR2; PDGFR-2; RHEPDGFRA; PDGFR2; RHEPDGFRA; PDGF-R-alpha; PDGFR-alpha; PDGFR-2] |
| Gene, Accession # | [PDGFRA], Gene ID: 5156, NCBI: NP_006197.1, UniProt: P16234 |
| Catalog # | MBS177758 |
| Price | $315 |
| Order / More Info | PDGFRA Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Baxter, E. J., Hochhaus, A., Bolufer, P., Reiter, A., Fernandez, J. M., Senent, L., Cervera, J., Moscardo, F., Sanz, M. A., Cross, N. C. P. The t(4;22)(q12;q11) in atypical chronic myeloid leukaemia fuses BCR to PDGFRA. Hum. Molec. Genet. 11: 1391-1397, 2002. 2. Chen, H., Gu, X., Liu, Y., Wang, J., Wirt, S. E., Bottino, R., Schorle, H., Sage, J., Kim, S, K. PDGF signalling controls age-dependent proliferation in pancreatic beta-cells. Nature 478: 349-355, 2011. 3. Chompret, A., Kannengiesser, C., Barrois, M., Terrier, P., Dahan, P., Tursz, T., Lenoir, G. M., Bressac-De Paillerets, B. PDGFRA germline mutation in a family with multiple cases of gastrointestinal stromal tumor. Gastroenterology 126: 318-321, 2004. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies