Hexokinase II Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Hexokinase II antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Hexokinase II |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Hexokinase-2 (HK2) detection. Background: Hexokinase 2, also known as HK2, is an enzyme which in humans is encoded by the HK2 gene on chromosome 2. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Hexokinase II (460-497aa AYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEME R), different from the related mouse and rat sequences by four amino acids. |
| Other Names | [Hexokinase2; Hexokinase-2; Hexokinase 2; Hexokinase 2 muscle; Hexokinase type II; HK 2; HK2; HK II; HKII; HxK 2; HxK2; P52789], [HK2; HK2; HKII; HXK2; HK II] |
| Gene, Accession # | [HK2], Gene ID: 3099, NCBI: NP_000180.2, UniProt: P52789 |
| Catalog # | MBS178645 |
| Price | $280 |
| Order / More Info | Hexokinase II Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: HK2 hexokinase 2.2. Printz RL, Osawa H, Ardehali H, Koch S, Granner DK (Feb 1997). Hexokinase II gene: structure, regulation and promoter organization. Biochemical Society Transactions. 25 (1): 107-12.3. Peng Q, Zhou J, Zhou Q, Pan F, Zhong D, Liang H (2009). Silencing hexokinase II gene sensitizes human colon cancer cells to 5-fluorouracil. Hepato-Gastroenterology. 56 (90): 355-60. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies