Edit |   |
---|---|
Antigenic Specificity | Factor II |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Factor II antibody |
Immunogen | Immunogen: Factor II antibody was raised using a synthetic peptide corresponding to a region with amino acids KYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSW |
Other Names | [Factor II; Factor II; CF2R; HTR; F2R; Coagulation Factor Ii; TR; PAR1; Thrombin Receptor] |
Gene, Accession # | n/a |
Catalog # | MBS5300188 |
Price | $430 |
Order / More Info | Factor II Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |