FOXA3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-FOXA3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | FOXA3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human;Mouse;Rat. Background: Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [Hepatocyte nuclear factor 3-gamma; FKHH3; Fork head-related protein FKH H3; forkhead box A3; Forkhead box protein A3; Foxa3; FOXA3_HUMAN; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3; hepatocyte nuclear factor 3 gamma; Hepatocyte nuclear factor 3-gamma; HNF-3-gamma; HNF-3G; HNF3B; HNF3G; TCF-3G; TCF3G; Transcription factor 3G; forkhead box A3], [FOXA3; FOXA3; FKHH3; HNF3G; TCF3G; HNF3G; TCF3G; HNF-3-gamma; HNF-3G; TCF-3G] |
| Gene, Accession # | [FOXA3], Gene ID: 3171, NCBI: NP_004488.2, UniProt: P55318 |
| Catalog # | MBS178032 |
| Price | $280 |
| Order / More Info | FOXA3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: forkhead box A3. 2. Mincheva A, Lichter P, Schutz G, Kaestner KH (February 1997). Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4.Genomics 39 (3): 417-9. 3. Navas MA, Vaisse C, Boger S; et al. (2000). The human HNF-3 genes: cloning, partial sequence and mutation screening in patients with impaired glucose homeostasis.. Hum. Hered. 50 (6): 370-81. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies