Human CHRNA3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Human CHRNA3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Human CHRNA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | DyLight 488 conjugate |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Flow Cytometry (FC/FACS) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Neuronal acetylcholine receptor subunit alpha-3, also known as nAChRalpha3, is a protein that in humans is encoded by the CHRNA3 gene. This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcrip |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD). |
| Other Names | [Rabbit IgG Human CHRNA3 DyLight 488 Conjugated, Flow Validated; Neuronal acetylcholine receptor subunit alpha-3; CHRNA3; NACHRA3; Cholinergic receptor nicotinic alpha 3 subunit] |
| Gene, Accession # | [CHRNA3], Gene ID: 1136, NCBI: NP_000734.2, UniProt: P32297 |
| Catalog # | MBS1751400 |
| Price | $330 |
| Order / More Info | Human CHRNA3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: CHRNA3 cholinergic receptor, nicotinic, alpha 3. 2. Eng CM, Kozak CA, Beaudet AL, Zoghbi HY (Apr 1991). Mapping of multiple subunits of the neuronal nicotinic acetylcholine receptor to chromosome 15 in man and chromosome 9 in mouse. Genomics. 9 (2): 278-82. 3. Mihovilovic M, Roses AD (1991). Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor.. Exp. Neurol. 111 (2): 175-80. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies