EME1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-EME1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | EME1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1(EME1) detection. Tested with WB, IHC-P in Human;Rat. Background: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ), different from the related mouse sequence by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Crossover junction endonuclease EME1; 6820428D13; Crossover junction endonuclease EME1; EC 3.1.22.-; EME1; Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe); EME1, S. pombe, homolog of, 1; EME1_HUMAN; essential meiotic endonuclease 1 homolog 1 (S pombe); Essential Meiotic Endonuclease 1 Homolog 1; essential meiotic endonuclease 1 homolog 2; Essential meiotic endonuclease 1, S. pombe, homolog of, 1; FLJ31364; hMMS4; homolog of yeast EME1 endonuclease; MGC106543; MMS4; MMS4 homolog; MMS4L; essential meiotic structure-specific endonuclease 1], [EME1; EME1; MMS4L; SLX2A; MMS4; hMMS4] |
| Gene, Accession # | [EME1], Gene ID: 146956, NCBI: NP_001159603.1, UniProt: Q96AY2 |
| Catalog # | MBS177915 |
| Price | $315 |
| Order / More Info | EME1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: EME1 essential meiotic endonuclease 1 homolog 1 (S. pombe). 2. Abraham, J., Lemmers, B., Hande, M. P., Moynahan, M. E., Chahwan, C., Ciccia, A., Essers, J., Hanada, K., Chahwan, R., Khaw, A. K., McPherson, P., Shehabeldin, A., Laister, R., Arrowsmith, C., Kanaar, R., West, S. C., Jasin, M., Hakem, R. Eme1 is involved in DNA damage processing and maintenance of genomic stability in mammalian cells. EMBO J. 22: 6137-6147, 2003. 3. Ciccia A, Constantinou A, West SC (Jun 2003). Identification and characterization of the human mus81-eme1 endonuclease. J Biol Chem 278 (27): 25172-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies