Edit |   |
---|---|
Antigenic Specificity | ZSWIM3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: ZSWIM3 antibody was raised against the N terminal of ZSWIM3. Rabbit polyclonal ZSWIM3 antibody raised against the N terminal of ZSWIM3 |
Immunogen | Immunogen: ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY |
Other Names | [ZSWIM3; ZSWIM3; ZSWIM 3; ZSWIM3; C20orf164; ZSWIM-3; Zinc Finger Swim-Type Containing 3] |
Gene, Accession # | [ZSWIM3] |
Catalog # | MBS5302454 |
Price | $430 |
Order / More Info | ZSWIM3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |