IGFBP2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IGFBP2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IGFBP2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human;Rat. Background: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modif |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid. Ig Type: Rabbit IgG |
| Other Names | [Insulin-like growth factor-binding protein 2; BP 2; BP2; IBP 2; IBP-2; IBP2; IBP2_HUMAN; IGF binding protein 2; IGF BP53; IGF-binding protein 2; IGFBP 2; IGFBP-2; IGFBP2; IGFBP53; Insulin like growth factor binding protein 2 36kDa; Insulin like growth factor binding protein 2; Insulin like growth factor-binding protein 2 precursor; Insulin-like growth factor-binding protein 2; insulin-like growth factor binding protein 2, 36kDa], [IGFBP2; IGFBP2; IBP2; IGF-BP53; BP2; IBP2; IBP-2; IGF-binding protein 2; IGFBP-2] |
| Gene, Accession # | [IGFBP2], Gene ID: 3485, NCBI: NP_000588.2, UniProt: P18065 |
| Catalog # | MBS178300 |
| Price | $280 |
| Order / More Info | IGFBP2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Chesik D, De Keyser J, Wilczak N (2007). Insulin-like growth factor binding protein-2 as a regulator of IGF actions in CNS: implications in multiple sclerosis.. Cytokine Growth Factor Rev. 18 (3-4): 267-78. 2. Wolf E, Lahm H, Wu M et al. (2000). Effects of IGFBP-2 overexpression in vitro and in vivo..Pediatr. Nephrol. 14 (7): 572-8. 3. Zapf J, Kiefer M, Merryweather J, Musiarz F, Bauer D, Born W, Fischer JA, Froesch ER (Oct 1990). Isolation from adult human serum of four insulin-like growth factor (IGF) binding proteins and molecular cloning of one of them that is increased by IGF I administration and in extrapancreatic tumor hypoglycemia.J Biol Chem 265 (25): 14892-8. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies