GSK3 alpha Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-GSK3 alpha Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | GSK3 alpha Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. Protein Function: Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR). |
| Other Names | [Glycogen synthase kinase-3 alpha; GSK-3 alpha; Serine/threonine-protein kinase GSK3A; GSK3A] |
| Gene, Accession # | [GSK3A], Gene ID: 2931, NCBI: NP_063937.2, UniProt: P49840 |
| Catalog # | MBS1750816 |
| Price | $280 |
| Order / More Info | GSK3 alpha Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies