Edit |   |
---|---|
Antigenic Specificity | UBXD3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: UBXD3 antibody was raised against the middle region of UBXD3. Rabbit polyclonal UBXD3 antibody raised against the middle region of UBXD3 |
Immunogen | Immunogen: UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI |
Other Names | [UBXD3; UBXD3; FLJ25429; UBXD 3; UBXD3; Ubx Domain Protein 10; UBXD-3] |
Gene, Accession # | [UBXD3] |
Catalog # | MBS5303184 |
Price | $460 |
Order / More Info | UBXD3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |