Edit |   |
---|---|
Antigenic Specificity | HP1BP3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: HP1BP3 antibody was raised against the middle region of HP1BP3. Rabbit polyclonal HP1BP3 antibody raised against the middle region of HP1BP3 |
Immunogen | Immunogen: HP1BP3 antibody was raised using the middle region of HP1BP3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL |
Other Names | [HP1BP3; HP1BP3; RP5-930J4.3; MGC43701; HPBP3 1; HP1-BP74; HPBP3-1; Heterochromatin Protein 1 Binding Protein 3; HP1BP3] |
Gene, Accession # | [HP1BP3], Gene ID: 50809, NCBI: AAH32139.1 |
Catalog # | MBS5301469 |
Price | $430 |
Order / More Info | HP1BP3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |