ATG14L Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ATG14L antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ATG14L |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P in Human;Rat. Background: ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [Beclin 1-associated autophagy-related key regulator; 4832427M01; ATG14; Atg14L; Autophagy-related protein 14-like protein; BAKOR_HUMAN; Barkor; Beclin 1-associated autophagy-related key regulator; D14Ertd114e; D14Ertd436e; KIAA0831; mCG_6911; autophagy related 14], [ATG14; ATG14; ATG14L; BARKOR; KIAA0831; Atg14L] |
| Gene, Accession # | [ATG14L], Gene ID: 22863, NCBI: NP_055739.2, UniProt: Q6ZNE5 |
| Catalog # | MBS178045 |
| Price | $315 |
| Order / More Info | ATG14L Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Diao J; Liu R; Rong Y; Zhao M; Zhang J; Lai Y; Zhou Q; Wilz LM; Li J; Vivona S; Pfuetzner RA; Brunger AT; Zhong Q. ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes. Nature, 2015 Apr 23. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies