Edit |   |
---|---|
Antigenic Specificity | IARS |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: IARS antibody was raised against the middle region of IARS. Rabbit polyclonal IARS antibody raised against the middle region of IARS |
Immunogen | Immunogen: IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD |
Other Names | [IARS; IARS; PRO0785; IARS1; ILRS; Isoleucyl-tRNA Synthetase; FLJ20736], [IARS; IARS; IRS; ILRS; IARS1; ILERS; PRO0785; IRS; IleRS] |
Gene, Accession # | [IARS], Gene ID: 3376, NCBI: AAH65552.1 |
Catalog # | MBS838842 |
Price | $430 |
Order / More Info | IARS Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |