TSG6 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TSG6 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TSG6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such a |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids. |
| Other Names | [TNFAIP 6; Tnfaip6; TSG 6; TSG-6; P98066; Tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6], [TNFAIP6; TNFAIP6; TSG6; TSG-6; TSG6; TSG-6; TNF alpha-induced protein 6] |
| Gene, Accession # | [TNFAIP6], Gene ID: 7130, NCBI: NP_009046.2, UniProt: P98066 |
| Catalog # | MBS178683 |
| Price | $280 |
| Order / More Info | TSG6 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: TNFAIP6 tumor necrosis factor, alpha-induced protein 6.2. Lee TH, Klampfer L, Shows TB, Vilcek J (March 1993). Transcriptional regulation of TSG6, a tumor necrosis factor- and interleukin-1-inducible primary response gene coding for a secreted hyaluronan-binding protein. J. Biol. Chem. 268 (9): 6154-60.3. Milner CM, Day AJ (2004). TSG-6: a multifunctional protein associated with inflammation.. J. Cell. Sci. 116 (Pt 10): 1863-73. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies