Edit |   |
---|---|
Antigenic Specificity | LILRB3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.91 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding differ |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP 001307889.1). Immunogen Sequence: RSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGGPEDQPLNPPGSGPQNGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKTDFQ |
Other Names | [LILRB3; CD85A; HL9; ILT-5; ILT5; LILRA6; LIR-3; LIR3; PIR-B; PIRB; leukocyte immunoglobulin like receptor B3] |
Gene, Accession # | [LILRB3], Gene ID: 11025, NCBI: NP_001074919.2, UniProt: O75022 |
Catalog # | MBS9140717 |
Price | $260 |
Order / More Info | LILRB3 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |