SAPK4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SAPK4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SAPK4 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4(SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP ki |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4 (332-365aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids. Ig Type: Rabbit IgG |
| Other Names | [Mitogen-activated protein kinase 13; MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; Mapk13; MGC99536; Mitogen activated protein kinase 13; Mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; MK13_HUMAN; OTTHUMP00000016282; OTTHUMP00000016283; p38 delta; P38delta; PRKM13; SAPK 4; SAPK4; Stress activated protein kinase 4; Stress-activated protein kinase 4; mitogen-activated protein kinase 13], [MAPK13; MAPK13; SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta; PRKM13; SAPK4; MAP kinase 13; MAPK 13; MAP kinase p38 delta] |
| Gene, Accession # | [SAPK4], Gene ID: 5603, NCBI: NP_002745.1, UniProt: O15264 |
| Catalog # | MBS177654 |
| Price | $315 |
| Order / More Info | SAPK4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Goedert, M., Cuenda, A., Craxton, M., Jakes, R., Cohen, P. Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases. EMBO J. 16: 3563-3571, 1997. 2. Kumar, S., McDonnell, P. C., Gum, R. J., Hand, A. T., Lee, J. C., Young, P. R. Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles. Biochem. Biophys. Res. Commun. 235: 533-538, 1997. 3. Wang, X. S., Diener, K., Manthey, C. L., Wang, S., Rosenzweig, B., Bray, J., Delaney, J., Cole, C. N., Chan-Hui, P.-Y., Mantlo, N., Lichenstein, H. S., Zukowski, M., Yao, Z. Molecular cloning and characterization of a novel p38 mitogen-activated protein kinase. J. Biol. Chem. 272: 23668-23674, 1997. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies