Nanog Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Nanog antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Nanog |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Background: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids. |
| Other Names | [ENK; NANOG; Q9H9S0; Homeobox protein NANOG; Nanog homeobox], [NANOG; NANOG; hNanog] |
| Gene, Accession # | [NANOG], Gene ID: 79923, NCBI: NP_001284627.1, UniProt: Q9H9S0 |
| Catalog # | MBS178590 |
| Price | $280 |
| Order / More Info | Nanog Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Chambers, I., Colby, D., Robertson, M., Nichols, J., Lee, S., Tweedie, S., Smith, A. Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. Cell 113: 643-655, 2003.2. Clark, A. T., Rodriguez, R. T., Bodnar, M. S., Abeyta, M. J., Cedars, M. I., Turek, P. J., Firpo, M. T., Pera, R. A. R. Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent cells and map to chromosome 12p13, a hotspot for teratocarcinoma. Stem Cells 22: 169-179, 2004.3. Hart, A. H., Hartley, L., Ibrahim, M., Robb, L. Identification, cloning and expression analysis of the pluripotency promotingNanog genes in mouse and human. Dev. Dyn. 230: 187-198, 2004. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies